Pharmacology Complete List of Endogenous Ligands and Other Peptides

$447.50 / year

This dataset shows the complete list of Endogenous Ligands and Other Peptides from the Guide to PHARMACOLOGY; an online, open-access portal to pharmacological information on all the human targets of prescription drugs, which is the product from the collaboration of the International Union of Basic and Clinical Pharmacology (IUPHAR) and the British Pharmacological Society (BPS).

Complexity

The data types captured in this dataset include target nomenclature, pharmacological data, and ligand structures. Organisms isolated in this data are from human, mouse, and rat.

In future versions, the plan is to add resources for education and training in pharmacological principles and techniques along with research guidelines and overviews of key topics. It is the hope of IUPHAR/BPS Guide to PHARMACOLOGY to be useful for researchers and students in pharmacology and drug discovery and provide the general public with accurate information on the basic science underlying drug action.

The information provided in this dataset shows the initial view or landing pages for each target family that provides expert-curated overviews of the key properties and selective ligands and tool compounds available. Additional information can be found also in other databases including Ensembl, UniProt, PubChem, ChEMBL, and DrugBank, as well as curated chemical information and literature citations in PubMed.

Endogenous ligands include metabolites, hormones, neurotransmitters, and cytokines.

Date Created

2011

Last Modified

2020-03-12

Version

2020.2

Update Frequency

Quarterly

Temporal Coverage

N/A

Spatial Coverage

N/A

Source

John Snow Labs; International Union of Basic and Clinical Pharmacology (IUPHAR) and the British Pharmacological Society (BPS) Guide to PHARMACOLOGY;

Source License URL

Source License Requirements

N/A

Source Citation

Southan C, Sharman JL, Benson HE, Faccenda E, Pawson AJ, Alexander SPH, Buneman OP, Davenport AP, McGrath JC, Peters JA, Spedding M, Catterall WA, Fabbro D, Davies JA; NC-IUPHAR. (2016) The IUPHAR/BPS Guide to PHARMACOLOGY in 2016 towards curated quantitative interactions between 1300 protein targets and 6000 ligands. Nucl. Acids Res. 44 (Database Issue) D1054-68

Keywords

Peptide, Antigen Presenting Cells, Endogenous Opioid Peptides, Antimicrobial Peptides, Endogenous Opioids, Antimicrobial, Peptide, Peptides for Skin

Other Titles

Pharmacology Complete List of Peptides, Pharmacology Complete List of Endogenous Opioid Peptides, Pharmacology Complete List of Antimicrobial Peptides, Pharmacology Complete List of Endogenous Opioids

NameDescriptionTypeConstraints
Ligand_IdThe Guide to Pharmacology (GtP) ligand identifierintegerlevel : Nominal required : 1 unique : 1
Ligand_NameThe name of the ligand wherein the Guide to Pharmacology (GtoPdb) context, the term ‘ligand’ is used mostly for small molecule-to-large molecule interactions but it does extend to selected protein-protein interactions (e.g. cytokines-to-receptors or antibodies-to-cytokines).stringrequired : 1
SpeciesThe species which endogenously express a particular peptide ligand sequencestring-
Endogenous_or_Peptide_TypeEither endogenous (in human, mouse or rat) or other (in other species or synthetic) peptide.stringrequired : 1
Subunit_IdsThe Guide to Pharmacology (GtP) ligand identifiers of any subunit polypeptidesstring-
Subunit_NamesThe names of any subunits that make up a multimeric proteinstring-
Is_ApprovedA version of this peptide (possibly produced synthetically) is or has in the past been approved for human clinical use by a regulatory agencyboolean-
Is_WithdrawnThe drug is no longer approved for its original clinical use in one or more countriesboolean-
Is_LabelledThe peptide has been labeled with a chemical group such as a fluorescent tag or unstable isotopeboolean-
Is_RadioactiveHas been labeled with a radioactive isotopeboolean-
PubChem_Substance_IdentifierThe PubChem Substance identifier assigned when we deposited the ligand in PubChemstring-
PubChem_Compound_DatabaseCurated PubChem Compound database linkintegerlevel : Ordinal
UniProt_IdThe UniProtKB/SwissProt Accession for the (parent) peptide sequencestring-
International_Non_Proprietary_NameThe International Non-proprietary Name (INN)assigned by the WHOstring-
Single_Letter_Amino_Acid_SequenceSingle letter amino acid representation of the sequencestring-
Three_Letter_Amino_Acid_SequenceThree letter amino acid representation of the sequence, including non-standard amino acids and chemical groupsstring-
Post_Translational_ModificationDetails of any post-translational modifications for endogenous peptidesstring-
Chemical_ModificationDetails of any chemical groups or modifications for synthetic peptidesstring-
Simplified_Molecular_Input_Line_Entry_SystemFor some peptides, the chemical structure is also given in canonical, isomeric Simplified Molecular Input Line Entry System (SMILES)string-
International_Chemical_Identifier_KeyA hashed version of the full International Chemical Identifier (InChI) designed for easy web searches of chemical compoundsstring-
Ligand IdLigand NameSpeciesEndogenous or Peptide TypeSubunit IdsSubunit NamesIs ApprovedIs WithdrawnIs LabelledIs RadioactivePubChem Substance IdentifierPubChem Compound DatabaseUniProt IdInternational Non Proprietary NameSingle Letter Amino Acid SequenceThree Letter Amino Acid SequencePost Translational ModificationChemical ModificationSimplified Molecular Input Line Entry SystemInternational Chemical Identifier Key
50814-1BB ligandHumanEndogenous peptide in human, mouse or rat178101774P41273MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
51835-LOX activating proteinHumanEndogenous peptide in human, mouse or rat178101873P20292MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
1331ACTHMouse, RatEndogenous peptide in human, mouse or rat135651599P01194|P01193SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEFSer-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-PheNone.
3633ACTHHumanEndogenous peptide in human, mouse or ratTrue135651598134611880.0P01189corticotropinSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFSer-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-PheNone.NCCCC[C@@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)O)Cc1ccccc1)CCC(=O)O)CC(C)C)Cc1ccccc1)C)CCC(=O)O)C)CO)CCC(=O)O)CC(=O)O)CCC(=O)O)C)CC(=O)N)Cc1ccc(cc1)O)C(C)C)NC(=O)[C@H](C(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](C(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)CNC(=O)[C@H](Cc1c[nH]c2c1cccc2)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CO)N)Cc1ccc(cc1)O)CO)CCSC)CCC(=O)O)Cc1nc[nH]c1)Cc1ccccc1)CCCN=C(N)N)CCCCN)CCCCN)CCCCN)CCCN=C(N)N)CCCN=C(N)NIDLFZVILOHSSID-OVLDLUHVSA-N
4857activin AHumanEndogenous peptide in human, mouse or rat5006inhibin βA178101558
4858activin ABHumanEndogenous peptide in human, mouse or rat5006|5007inhibin βA|inhibin βB178101559
4859activin BHumanEndogenous peptide in human, mouse or rat5007inhibin βB178101560
3726adiponectinHumanEndogenous peptide in human, mouse or rat135651745Q15848ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTNGlu-Thr-Thr-Thr-Gln-Gly-Pro-Gly-Val-Leu-Leu-Pro-Leu-Pro-Lys-Gly-Ala-Cys-Thr-Gly-Trp-Met-Ala-Gly-Ile-Pro-Gly-His-Pro-Gly-His-Asn-Gly-Ala-Pro-Gly-Arg-Asp-Gly-Arg-Asp-Gly-Thr-Pro-Gly-Glu-Lys-Gly-Glu-Lys-Gly-Asp-Pro-Gly-Leu-Ile-Gly-Pro-Lys-Gly-Asp-Ile-Gly-Glu-Thr-Gly-Val-Pro-Gly-Ala-Glu-Gly-Pro-Arg-Gly-Phe-Pro-Gly-Ile-Gln-Gly-Arg-Lys-Gly-Glu-Pro-Gly-Glu-Gly-Ala-Tyr-Val-Tyr-Arg-Ser-Ala-Phe-Ser-Val-Gly-Leu-Glu-Thr-Tyr-Val-Thr-Ile-Pro-Asn-Met-Pro-Ile-Arg-Phe-Thr-Lys-Ile-Phe-Tyr-Asn-Gln-Gln-Asn-His-Tyr-Asp-Gly-Ser-Thr-Gly-Lys-Phe-His-Cys-Asn-Ile-Pro-Gly-Leu-Tyr-Tyr-Phe-Ala-Tyr-His-Ile-Thr-Val-Tyr-Met-Lys-Asp-Val-Lys-Val-Ser-Leu-Phe-Lys-Lys-Asp-Lys-Ala-Met-Leu-Phe-Thr-Tyr-Asp-Gln-Tyr-Gln-Glu-Asn-Asn-Val-Asp-Gln-Ala-Ser-Gly-Ser-Val-Leu-Leu-His-Leu-Glu-Val-Gly-Asp-Gln-Val-Trp-Leu-Gln-Val-Tyr-Gly-Glu-Gly-Glu-Arg-Asn-Gly-Leu-Tyr-Ala-Asp-Asn-Asp-Asn-Asp-Ser-Thr-Phe-Thr-Gly-Phe-Leu-Leu-Tyr-His-Asp-Thr-Asn
5305ADP-ribosylation factor 1HumanEndogenous peptide in human, mouse or rat178101987P84077GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQKSerine residue at position 146 is phosphoserine; N-terminal glycine residue undergoes lipidation to N-myristoyl glycine
683adrenomedullinHumanEndogenous peptide in human, mouse or rat135651602P35318YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYTyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2The cysteine residues at positions 16 and 21 form a disulphide bridge and the C-terminal tyrosine is amidated.