Others titles
- Pharmacology Complete List of Peptides
- Pharmacology Complete List of Endogenous Opioid Peptides
- Pharmacology Complete List of Antimicrobial Peptides
- Pharmacology Complete List of Endogenous Opioids
Keywords
- Peptide
- Antigen Presenting Cells
- Endogenous Opioid Peptides
- Antimicrobial Peptides
- Endogenous Opioids
- Antimicrobial
- Peptide
- Peptides for Skin
Pharmacology Complete List of Endogenous Ligands and Other Peptides
![Pharmacology Complete List of Endogenous Ligands and Other Peptides](https://www.johnsnowlabs.com/wp-content/uploads/2018/09/normal/Gene-Products-and-Targets.png)
This dataset shows the complete list of Endogenous Ligands and Other Peptides from the Guide to PHARMACOLOGY; an online, open-access portal to pharmacological information on all the human targets of prescription drugs, which is the product from the collaboration of the International Union of Basic and Clinical Pharmacology (IUPHAR) and the British Pharmacological Society (BPS).
Get The Data
- Research
Non-Commercial,
Share-Alike,
Attribution Free Forever
- Commercial
Commercial Use,
Remix & Adapt,
White Label Log in to download
Description
The data types captured in this dataset include target nomenclature, pharmacological data, and ligand structures. Organisms isolated in this data are from human, mouse, and rat.
In future versions, the plan is to add resources for education and training in pharmacological principles and techniques along with research guidelines and overviews of key topics. It is the hope of IUPHAR/BPS Guide to PHARMACOLOGY to be useful for researchers and students in pharmacology and drug discovery and provide the general public with accurate information on the basic science underlying drug action.
The information provided in this dataset shows the initial view or landing pages for each target family that provides expert-curated overviews of the key properties and selective ligands and tool compounds available. Additional information can be found also in other databases including Ensembl, UniProt, PubChem, ChEMBL, and DrugBank, as well as curated chemical information and literature citations in PubMed.
Endogenous ligands include metabolites, hormones, neurotransmitters, and cytokines.
About this Dataset
Data Info
Date Created | 2011 |
---|---|
Last Modified | 2024-03-26 |
Version | 2024.1 |
Update Frequency |
Quarterly |
Temporal Coverage |
N/A |
Spatial Coverage |
N/A |
Source | John Snow Labs; International Union of Basic and Clinical Pharmacology (IUPHAR) and the British Pharmacological Society (BPS) Guide to PHARMACOLOGY; |
Source License URL | |
Source License Requirements |
N/A |
Source Citation |
N/A |
Keywords | Peptide, Antigen Presenting Cells, Endogenous Opioid Peptides, Antimicrobial Peptides, Endogenous Opioids, Antimicrobial, Peptide, Peptides for Skin |
Other Titles | Pharmacology Complete List of Peptides, Pharmacology Complete List of Endogenous Opioid Peptides, Pharmacology Complete List of Antimicrobial Peptides, Pharmacology Complete List of Endogenous Opioids |
Data Fields
Name | Description | Type | Constraints |
---|---|---|---|
Ligand_Id | The Guide to Pharmacology (GtP) ligand identifier | integer | level : Nominalrequired : 1unique : 1 |
Ligand_Name | The name of the ligand wherein the Guide to Pharmacology (GtoPdb) context, the term ‘ligand’ is used mostly for small molecule-to-large molecule interactions but it does extend to selected protein-protein interactions (e.g. cytokines-to-receptors or antibodies-to-cytokines). | string | required : 1 |
Species | The species which endogenously express a particular peptide ligand sequence | string | - |
Endogenous_or_Peptide_Type | Either endogenous (in human, mouse or rat) or other (in other species or synthetic) peptide. | string | required : 1 |
Is_Approved | A version of this peptide (possibly produced synthetically) is or has in the past been approved for human clinical use by a regulatory agency | boolean | - |
Is_Withdrawn | The drug is no longer approved for its original clinical use in one or more countries | boolean | - |
Is_Labelled | The peptide has been labeled with a chemical group such as a fluorescent tag or unstable isotope | boolean | - |
Is_Radioactive | Has been labeled with a radioactive isotope | boolean | - |
PubChem_Substance_Identifier | The PubChem Substance identifier assigned when we deposited the ligand in PubChem | string | - |
PubChem_Compound_Database | Curated PubChem Compound database link | integer | level : Ordinal |
UniProt_Id | The UniProtKB/SwissProt Accession for the (parent) peptide sequence | string | - |
International_Non_Proprietary_Name | The International Non-proprietary Name (INN)assigned by the WHO | string | - |
Single_Letter_Amino_Acid_Sequence | Single letter amino acid representation of the sequence | string | - |
Three_Letter_Amino_Acid_Sequence | Three letter amino acid representation of the sequence, including non-standard amino acids and chemical groups | string | - |
Post_Translational_Modification | Details of any post-translational modifications for endogenous peptides | string | - |
Chemical_Modification | Details of any chemical groups or modifications for synthetic peptides | string | - |
Simplified_Molecular_Input_Line_Entry_System | For some peptides, the chemical structure is also given in canonical, isomeric Simplified Molecular Input Line Entry System (SMILES) | string | - |
International_Chemical_Identifier_Key | A hashed version of the full International Chemical Identifier (InChI) designed for easy web searches of chemical compounds | string | - |
Data Preview
Ligand Id | Ligand Name | Species | Endogenous or Peptide Type | Is Approved | Is Withdrawn | Is Labelled | Is Radioactive | PubChem Substance Identifier | PubChem Compound Database | UniProt Id | International Non Proprietary Name | Single Letter Amino Acid Sequence | Three Letter Amino Acid Sequence | Post Translational Modification | Chemical Modification | Simplified Molecular Input Line Entry System | International Chemical Identifier Key |
5081 | 4-1BB ligand | Human | Endogenous peptide in human, mouse or rat | 178101774 | P41273 | MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE | |||||||||||
5183 | 5-LOX activating protein | Human | Endogenous peptide in human, mouse or rat | 178101873 | P20292 | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP | |||||||||||
3633 | ACTH | Human | Endogenous peptide in human, mouse or rat | True | 135651598 | 134611880.0 | P01189 | corticotropin | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF | Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe | None. | NCCCC[C@@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)O)Cc1ccccc1)CCC(=O)O)CC(C)C)Cc1ccccc1)C)CCC(=O)O)C)CO)CCC(=O)O)CC(=O)O)CCC(=O)O)C)CC(=O)N)Cc1ccc(cc1)O)C(C)C)NC(=O)[C@H](C(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](C(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)CNC(=O)[C@H](Cc1c[nH]c2c1cccc2)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CO)N)Cc1ccc(cc1)O)CO)CCSC)CCC(=O)O)Cc1nc[nH]c1)Cc1ccccc1)CCCN=C(N)N)CCCCN)CCCCN)CCCCN)CCCN=C(N)N)CCCN=C(N)N | IDLFZVILOHSSID-OVLDLUHVSA-N | ||||
1331 | ACTH | Mouse, Rat | Endogenous peptide in human, mouse or rat | 135651599 | P01194|P01193 | SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF | Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe | None. | |||||||||
4857 | activin A | Human | Endogenous peptide in human, mouse or rat | 178101558 | P08476 | ||||||||||||
4858 | activin AB | Human | Endogenous peptide in human, mouse or rat | 178101559 | P08476|P09529 | ||||||||||||
4859 | activin B | Human | Endogenous peptide in human, mouse or rat | 178101560 | P09529 | ||||||||||||
3726 | adiponectin | Human | Endogenous peptide in human, mouse or rat | 135651745 | Q15848 | ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN | Glu-Thr-Thr-Thr-Gln-Gly-Pro-Gly-Val-Leu-Leu-Pro-Leu-Pro-Lys-Gly-Ala-Cys-Thr-Gly-Trp-Met-Ala-Gly-Ile-Pro-Gly-His-Pro-Gly-His-Asn-Gly-Ala-Pro-Gly-Arg-Asp-Gly-Arg-Asp-Gly-Thr-Pro-Gly-Glu-Lys-Gly-Glu-Lys-Gly-Asp-Pro-Gly-Leu-Ile-Gly-Pro-Lys-Gly-Asp-Ile-Gly-Glu-Thr-Gly-Val-Pro-Gly-Ala-Glu-Gly-Pro-Arg-Gly-Phe-Pro-Gly-Ile-Gln-Gly-Arg-Lys-Gly-Glu-Pro-Gly-Glu-Gly-Ala-Tyr-Val-Tyr-Arg-Ser-Ala-Phe-Ser-Val-Gly-Leu-Glu-Thr-Tyr-Val-Thr-Ile-Pro-Asn-Met-Pro-Ile-Arg-Phe-Thr-Lys-Ile-Phe-Tyr-Asn-Gln-Gln-Asn-His-Tyr-Asp-Gly-Ser-Thr-Gly-Lys-Phe-His-Cys-Asn-Ile-Pro-Gly-Leu-Tyr-Tyr-Phe-Ala-Tyr-His-Ile-Thr-Val-Tyr-Met-Lys-Asp-Val-Lys-Val-Ser-Leu-Phe-Lys-Lys-Asp-Lys-Ala-Met-Leu-Phe-Thr-Tyr-Asp-Gln-Tyr-Gln-Glu-Asn-Asn-Val-Asp-Gln-Ala-Ser-Gly-Ser-Val-Leu-Leu-His-Leu-Glu-Val-Gly-Asp-Gln-Val-Trp-Leu-Gln-Val-Tyr-Gly-Glu-Gly-Glu-Arg-Asn-Gly-Leu-Tyr-Ala-Asp-Asn-Asp-Asn-Asp-Ser-Thr-Phe-Thr-Gly-Phe-Leu-Leu-Tyr-His-Asp-Thr-Asn | ||||||||||
5305 | ADP-ribosylation factor 1 | Human | Endogenous peptide in human, mouse or rat | 178101987 | P84077 | GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK | Serine residue at position 146 is phosphoserine; N-terminal glycine residue undergoes lipidation to N-myristoyl glycine | ||||||||||
697 | adrenomedullin | Rat | Endogenous peptide in human, mouse or rat | 135651601 | P43145 | YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY | Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 | The cysteine residues at positions 14 and 19 form a disulphide bridge and the C-terminal tyrosine is amidated. |